SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021362 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021362
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 3.92e-31
Family BTB/POZ domain 0.0009
Further Details:      
 
Domain Number 2 Region: 609-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000073
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021362   Gene: ENSPPYG00000019062   Transcript: ENSPPYT00000022224
Sequence length 677
Comment pep:known_by_projection chromosome:PPYG2:9:24198074:24200107:1 gene:ENSPPYG00000019062 transcript:ENSPPYT00000022224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQ
TMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLT
TRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNSSQNGEEQPAPMSSSMRSNLD
QRTPFPMRRLHKRKQSAEERARQRLRPSMDESAISDVTPENGPSGVHSREEFFSPDSLKI
VDNPKADGMTDNQEDSAIMFDQSFGTQEDAQVPSQSDNSAGNMAQLSMASRATQVETSFD
QEAATEKSSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEG
VVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNN
FTANQNNDDNIPNTTSDCRLESEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVR
PMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMIGSPRGGASNFPYYRRIAP
KMPVVTSVRSSQIPENSTSSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALS
EHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHS
KTTCLRWQSSNLPSTLL
Download sequence
Identical sequences G7NF11 H2PRQ1
9600.ENSPPYP00000021362 XP_002819655.1.23681 XP_009242532.1.23681 ENSPPYP00000021362 ENSPPYP00000021362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]