SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021558 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021558
Domain Number 1 Region: 548-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.87e-18
Family Classic zinc finger, C2H2 0.0019
Further Details:      
 
Domain Number 2 Region: 591-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000215
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 500-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000058
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021558   Gene: ENSPPYG00000019250   Transcript: ENSPPYT00000022438
Sequence length 930
Comment pep:known_by_projection chromosome:PPYG2:9:58705219:59211138:1 gene:ENSPPYG00000019250 transcript:ENSPPYT00000022438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGRSCSMSLHRTSGTPQGPRMVSGQHIPAIRAHSGTPGPSPCGSTSSPTMGSLANNLHL
KMPLGGGMAPQNNVAESPIHLPALSPRRQMLTNGKPRFQVTQAGGMSGSHTLKPKQQEFG
SPFPPNPGKGALGFGPQCKSIGKGSCNNLVVTSSPMMVQRLGLISPPASQVSTACNQISP
SLQRAMNAANLNIPPSDTRSLISRESLASTTLSLTESQSASSMKQEWSQGYRALPSLSSN
HGSQNGLDLGDLLSLPPGTSMSSNSVSNSLPSYLFGMENSHSPYPSPRHSSTRSHSARSK
KRALSLSPLSDGIGIDFNTIIRTSPTSLVAYINGSRASPANMSPQPEVYGHFLGVRGSCI
PQPCPMPSGQKGVLVAPGGLALPAYGEDGALEYERMQQLEHGGLQPGLVNNMVVQHGLPG
PDSQPAGLFKTERLEEFPGSTVDLPPAPPLPPLPPPQGPPPPYHAHAHLHHPELGPHAQQ
LALSQAALDDDGEMDVGGKHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGEDFTCFWAG
CPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKPYLCQ
HPGCQKAFSNSSDRAKHQRTHLDTKPYVCQIPGCTKRYTDPSSLRKHVKAHSSKEQQARK
KLRSSTELHPDLLTDCLTVQPLQPATSPRDAAAEGTVGRSPGPGPDLYSAPIFSSNYSSR
SGTAAGAVPPPHPVSHPSPGHNVQGSPHNPSSQLPPLTAVDAGADRFAPSAPSPHHISPR
RVPAPSSILQRTQPPYTQQPSGSHLKSYPPETNSSFQPNGIHVHGFYGQLQKFCPPHYPD
SQRTVPPVSSCSVVPSFEDCLVPTSMGQAGFDVFHRAFSTHSGITVYDLPSSSSSLFGES
LRSGAEDATFLQISTVDRCPSQLSSVYTEG
Download sequence
Identical sequences H2PS90
9600.ENSPPYP00000021558 XP_002819875.1.23681 XP_009242748.1.23681 ENSPPYP00000021558 ENSPPYP00000021558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]