SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021737 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021737
Domain Number 1 Region: 439-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.92e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 11-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 243-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 383-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 525-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 345-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000437
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021737
Domain Number - Region: 488-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0974
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021737   Gene: ENSPPYG00000019396   Transcript: ENSPPYT00000022625
Sequence length 578
Comment pep:known_by_projection chromosome:PPYG2:9:89996401:90019113:1 gene:ENSPPYG00000019396 transcript:ENSPPYT00000022625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGLLTTRKEALMAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHLVSLGIAFSKP
KLIEQLEQGDEPWREENEHLLDLCPEPRTEFQPSLPHLVAFSSSQLLRQYALSGHPTQIF
PSSSAGGDFQLEAPRCSSEKGESGETEGPNSSLRKRPSRISRTFFSPHQGDPVEWVERNR
EGGIDLRLAQRMSLGGSDTMLKGVDTSESGPVIRGNYRLGLSKKSSLFSRQKHHVCPECG
RGFCQRSDLIKHQRTHTGEKPYLCPECGRRFSQKASLSIHQRKHSGEKPYVCRECGRHFR
YTSSLTNHKRIHSGERPFVCQECGRGFRQKIALILHQRTHLEEKPFVCPQCGRGFCQKAS
LLQHQSSHTGDRPFLCLECGRGFRQQSLLLSHQVTHSGEKPFVCAECGHSFRQKVTLIRH
QRTHTGEKPYLCPQCGRGFSQKVTLIGHQRTHTGEKPYLCPDCGRGFGQKVTLIRHQRTH
TGEKPYLCPECGRAFGFKSLLNRHQRTHSEEELYVDRVCGQGLGQKLHFISDQRTHSGEK
PCICDECGRGFGFKSALIRHQRTHSGEKPYVCRECGRG
Download sequence
Identical sequences H2PSR4
ENSPPYP00000021737 9600.ENSPPYP00000021737 ENSPPYP00000021737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]