SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021816 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021816
Domain Number 1 Region: 1830-1904
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-38
Family Classic zinc finger, C2H2 0.0000228
Further Details:      
 
Domain Number 2 Region: 2008-2058
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000543
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 2256-2304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000182
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 492-562
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000706
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021816
Domain Number - Region: 2148-2195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000545
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 1963-2016
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000745
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 2364-2392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00154
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 1424-1449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00324
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 393-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0171
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 839-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0265
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 797-825
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0366
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 1070-1093,1216-1241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0392
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 554-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0447
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 1616-1641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0795
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021816   Gene: ENSPPYG00000019476   Transcript: ENSPPYT00000022712
Sequence length 2462
Comment pep:known_by_projection chromosome:PPYG2:9:103235082:103325364:1 gene:ENSPPYG00000019476 transcript:ENSPPYT00000022712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNVNEPRCGSMNASNQTEVEFS
SIKDEFAIAEDLSGQNATALGTGGYYGHSPGYYGQHIAANPKPTNKFFQCKFCVRKVFSC
QFCTYKSPRRAIIKHQKMYHKNHLKTTAPPPAPVPMPDPVVPPVSLQDPCKELPAEVVER
SILESMVKPLTKSRGNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSSLRQQQEGTNLP
DVPNKSAPSPTSNSTYLTMNAASREIPNTTVSNFRGSMGNSIMRPNSSSASKFSPMSYPQ
MKPKSPHNSGLVNLAERSRYGMTDMTNSSADLETNSMLNDSSSDEELNEIDSENGLSAMD
HQTSGLSAEQLMGSDGNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSG
KTAVYKCDECPFTCKSSLKLGAHKQCHTGTTSDWDAVNSQSESISSSLNEGVVSYESSSI
NGRKSGVMLDPLQQQQPPQPPPPPPPPPPSQPQPLQQPQPPQLQPPHQVPPQPQTQPPPT
QQPQPPTQAAPLHPYKCTMCNYSTTTLKGLRVHQQHKHSFCDNLPKFEGQPSSLPLENET
DSHPSSSNTVKKSQTSILGLSSKNNFVAKASRKLANDFPLDLSPVKKRTRIDEIASNLQS
KINQTKQQEDAVINVEDDEEEEEDNEVEIEVELDREEEPTEPILEVPTAFSAQQIWARDT
SEPQKEPNFRNITHDYNATNGAEIELTLSEDEEDYYGSSTNLKDHQVSNSALLNTQTPIY
GTEHNNENTDFGDSGRLYYCKHCDFNNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAV
YRCLECYIDYTNFEDLQQHYGEHHPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQ
RMHPTVKINNAMIFSSYVVEQQEGLNTESQTLREILNSAPKNMATSTPVARGGGLPATFN
KNTPSKTFTPECENQKDPLVNTVVVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQ
KTMRMVSVDRGSALSQLSFEVGAPMSPKMSNMGSPPPPQPPPPDLSTELYYCKHCSYSNR
SVVGVLVHYQKRHPEIKVTAKYIRQAPPTAAMMRGVEGPQGSPRPPAPIQQLNRSSSERD
GPPVENEMFFCQHCDYGNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKKP
ASCVLVSPSNLERDKTKLRALKCRQCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFL
DGLIEAGYHCEWCIYSHTEPNGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSPPSLTMPA
EAKTYRCRDCVFEAVSIWDITNHYQAFHPWAMNGDESVLLDIIKEKDAVEKPILSSEELA
GPVNCENSIPTPLPEQEAECPEDARLSPEKSLQLASANPAISSTPYQCTVCQSEYNNLHG
LLTHYGKKHPGMKVKAADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPSIKVT
AEDFVHDVEQSADISQNDVEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPE
FDVFSQSPPKLPVPLEPEMTTEVSPSQISITEEEVGEEPVSTSHFSTSHLVSHTVFRCQL
CKYFCSTRKGIARHYRIKHNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDA
YYTHCLAASRTISDKPNKVIIPSPPKDDSPQLSEELRRAVEKKKCSLCSFQSFSKKGIVS
HYMKRHPGVFPKKQHASKLGGYFTAVYADEHEKPTLMEEEERGGFEKAEVEGEAQEIEWL
PFRCIKCFKLSFSTAELLCMHYTDHHSRDLKRDFIILGNGPRLQNSTYQCKHCDSKLQST
AELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQERPFGHLEEVPKIKERK
VVGYKCKFCVEVHPTLRAICNHLRKHVQYGNVPAVSAAVKGLRSHERSHLALAMFTREDK
YSCQYCSFVSAFRHNLDRHMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYK
CSWCSFSTMTISQLKEHSLKVHGKALTLPRPRIVSLLSSHSHHSSQKATPAEEVEDSNDS
SYSEPPDVQQQLNHYQSAALARNNSRVSPVPLSGAAAGTEQKTEAVLHCEFCEFSSGYIQ
SIRRHYRDKHGGKKLFKCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTK
YKRNMIDHIVLHREERVVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNE
LKPYKCQLCYYETKHTEELDSHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDED
KEEEMNSKAEDRELMRFSDHGAAINTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTK
QVSREEIHPKEIMENSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTADKSLLENAEAK
KE
Download sequence
Identical sequences H2PSZ0
ENSPPYP00000021816 9600.ENSPPYP00000021816 ENSPPYP00000021816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]