SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021862 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021862
Domain Number 1 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 494-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 539-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 12-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000209
Family KRAB domain (Kruppel-associated box) 0.0031
Further Details:      
 
Domain Number 8 Region: 456-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000635
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021862   Gene: ENSPPYG00000019511   Transcript: ENSPPYT00000022759
Sequence length 598
Comment pep:known_by_projection chromosome:PPYG2:9:109521363:109537022:-1 gene:ENSPPYG00000019511 transcript:ENSPPYT00000022759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSEPEASAAKEWKQLDPAQRNLYNDVMLENYSNQASMGCQAPKPDMISKLEKGEAPWL
GKGKRPSQGCPSKIARSKQKETDGKVQQDDDQLENNQKSQNKLLREVVVKKKTQAKKNGS
DCGSLGKKYNLHTKHVPSKKRLLKFESRGKILKQNLDLPDHSRNCVKGKSDAAKEHKKSF
NHSLSDTRKGKKQTGKKHEKLSNHSSSDKCNKTGKKHDKLCCHSSSHIKQDKIQTGEKHE
KSSSLSSSTKHEKPQVCVKPYECNQCGKVLSHKQGLIDHQRVHTGEKPYECNECGIAFSQ
KSHLVVHQRTHTGEKPYECIQCGKAHGHKHALTDHLRIHTGEKPYECAECGKTFRHSSNL
IQHVRSHTGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHM
RIHTGEKPFECNECGKAFSKKSHLIIHQRTHTKEKPYKCNECGKAFGHSSSLTYHMRTHT
GESPFECNQCGKGFKQIEGLTQHQRIHTGEKPYECNECGKAFSQKSHLIVHQRTHTGEKP
YECNECEKAFNAKSQLVIHQRSHTGEKPYECNECGKTFKQNASLTKHVKTHSEEKSHE
Download sequence
Identical sequences H2PT34
ENSPPYP00000021862 ENSPPYP00000021862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]