SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021969 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000021969
Domain Number - Region: 301-417
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 131-170
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0565
Family Outer membrane lipoprotein 0.0063
Further Details:      
 
Domain Number - Region: 486-528
Classification Level Classification E-value
Superfamily GRIP domain 0.0968
Family GRIP domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021969   Gene: ENSPPYG00000019605   Transcript: ENSPPYT00000022876
Sequence length 559
Comment pep:known_by_projection chromosome:PPYG2:9:121780371:121823984:-1 gene:ENSPPYG00000019605 transcript:ENSPPYT00000022876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAKLKKKIAEETAVAQRPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQL
LRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQANRAKM
AEGLALALARKDQEWSEKMDQLEKEKNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQE
LSKIKHMLLKKEESLGKMEQELEARTRELSRTQEELMNSNQMSSDLSQKLEELQRHYSTL
EEQRDHVIASKIGAESKITALEQKEQELQALIQQLSIDLQKKTLAEQNLEDTRQQLLAAR
SSQAKAINTLETRVRELEQTLQASEEQLQQSKGIVAAQEAQIQELAAANQESSRVQQQAL
ALEQQFLERTQALEAQIVALKRARAADQTAAEQGMRQLEQENAALKESRNEYERSLQSHQ
FELKKLKTIKQMQQRMLELRKTLQKELKIRPDNELFEVREKPGPEMANMAPSVTNNADLT
DAREINFEYLKHVVLKFMSCRESEAFHLIKAVSVLLNFSQEEENMLKETLEYKMSWFGSK
PAPKGSIRPSISNPRIPWS
Download sequence
Identical sequences H2PTD9
ENSPPYP00000021969 9600.ENSPPYP00000021969 ENSPPYP00000021969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]