SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022026 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000022026
Domain Number - Region: 589-699
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000154
Family Myosin rod fragments 0.0042
Further Details:      
 
Domain Number - Region: 113-275
Classification Level Classification E-value
Superfamily Tropomyosin 0.0399
Family Tropomyosin 0.0077
Further Details:      
 
Domain Number - Region: 248-338
Classification Level Classification E-value
Superfamily TROVE domain-like 0.0641
Family TROVE domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022026   Gene: ENSPPYG00000019655   Transcript: ENSPPYT00000022933
Sequence length 824
Comment pep:known chromosome:PPYG2:9:125428597:125480877:1 gene:ENSPPYG00000019655 transcript:ENSPPYT00000022933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSATSSQKSHKRGMKGDTVNVRRSVRVKTKV
PWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDK
KIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIER
MKEEKDFTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEKQMTCTD
INTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQGALLKRLAEADSEKA
RLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAENSRLCM
QIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYAEQLHV
QLADKDLYVAEALSTLESWRSRYNQVVKDKGDLELEIIVLNDRVTDLVNQQQTLEEKMRE
DRDSLVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYEGMIDN
YKSQVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLPDILKI
TEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENKQLSLK
VDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIEDARRQ
VEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQ
SESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA
Download sequence
Identical sequences H2PTJ5
XP_009243183.1.23681 ENSPPYP00000022026 ENSPPYP00000022026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]