SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022077 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022077
Domain Number 1 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 84-211
Classification Level Classification E-value
Superfamily SET domain 0.0000000000000458
Family Histone lysine methyltransferases 0.028
Further Details:      
 
Domain Number 3 Region: 244-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000921
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022077   Gene: ENSPPYG00000019694   Transcript: ENSPPYT00000022986
Sequence length 351
Comment pep:known_by_projection chromosome:PPYG2:9:127578903:127599447:1 gene:ENSPPYG00000019694 transcript:ENSPPYT00000022986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSVLPAEALVLKTGLKAPGLALAEVITSDILHSFLYGRWRNVLGEQLFEDKSHHASPK
TAFTAEVLAQSFSGEVQKLSSLVLPAEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGR
VIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQI
GTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEDQKKNKHEDFHPADSAAGPA
GRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYK
CQVCQSAYSQLAGLRAHQKSARHRPPSAVLQALSLVLPAPHAFSPVLAATA
Download sequence
Identical sequences H2PTP5
ENSPPYP00000022077 ENSPPYP00000022077 9600.ENSPPYP00000022077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]