SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022132 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022132
Domain Number 1 Region: 244-398
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-30
Family DnaQ-like 3'-5' exonuclease 0.0000996
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022132   Gene: ENSPPYG00000019735   Transcript: ENSPPYT00000023041
Sequence length 421
Comment pep:known_by_projection chromosome:PPYG2:9:130351856:130366595:-1 gene:ENSPPYG00000019735 transcript:ENSPPYT00000023041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKAKVPASKGASSSPVAKPGPVKTLTRKKNKKKKRFWKSKAQEVSKKPASGPGAVVRPP
KAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMP
AGKDQEASRGSVPSGSKMDRKAQVPRTKASGAEHNKKGTKERTNGDIVPERGDIKHKKRK
AKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSISLSLVKEQAFSGL
TRALALDCEMVGVGPKGEESVAARVSIVNQYGKCVYDKYVKPTEPVTDYRTAVSGIRPEN
LKQGEVLEVVQKEVAEMLKGRILVGHALHNDLKVLFLDHPKKIRDTQKYKPFKSQVKSGR
PSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLYVTVKKEWESMARERRPLLTAPDHCSDD
A
Download sequence
Identical sequences H2PTU8
9600.ENSPPYP00000022132 ENSPPYP00000022132 ENSPPYP00000022132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]