SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022133 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022133
Domain Number 1 Region: 80-252
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.3e-31
Family Reprolysin-like 0.006
Further Details:      
 
Domain Number 2 Region: 362-418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000536
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 717-784
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 
Domain Number 4 Region: 1046-1110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 998-1052
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 
Domain Number 6 Region: 1275-1385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000497
Family Spermadhesin, CUB domain 0.015
Further Details:      
 
Domain Number 7 Region: 931-992
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000123
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 8 Region: 1169-1254
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000051
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000022133
Domain Number - Region: 663-722
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00353
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022133   Gene: ENSPPYG00000019736   Transcript: ENSPPYT00000023042
Sequence length 1407
Comment pep:known_by_projection chromosome:PPYG2:9:130371388:130408087:1 gene:ENSPPYG00000019736 transcript:ENSPPYT00000023042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQRHPRARCPPLCVAGILACGFLLGCWGPSRFQQSCLQALEPQAVSSYLSPGAPLKGHP
PSPGFQRQRQRQRRAAGSILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSL
GAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSRAINPEDDTDPGHADLVLYITR
FDLELPDGNRQVRGVTQLGGACSPTWSCLITEDTGFDLGVTIAHEIGHSFGEHDGAPGSG
CGPSGHVMASDGAAPAGRARCVWDPPRPQPGSAGRPPEAQPGLYYSANEQCRVAFGPKAV
ACTFSREHLDMCQALSCHTDPLDQSSCSRLLVPLLDGTECGVEKWCSKGRCRSLVELTPI
AAVHGRWSSWGPQSPCSRSCGGGVVTRRRQCNNPRPAFGGRACVGADLQAEMCNTQACEK
TQLEFMSEQCARTDGQPLRSSPGGASFHHWGAAVPHSQGDALCRHMCRAIGESFIMKRGD
SFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMDSQQVWDACQVCGGDNSTCSPRKG
SFTAGRAREYVTFLTVTPNLTSVYXXNHRPLFTHLAVRLGGRYVVAGKTSISPNTTYPSL
LEDGRIEYRVALTEDRLPRLEEIHIWGPLQEDAEIQVYRRYGEEYGNLTCPDITFTYFQP
KPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQAREELAETLRCQGSQQPPAWPEACVLE
PCPPYWVGGDFGPCSASCGGGLRERPVHCVEAHGSLLKTLPPARCRAGAQQPAVAVETCN
PQPCPARWEVSDPSPCTSAGGAGLALENETCVPGADGLEAPATEGPGSVDKKLPAPEPCV
GMSCPPGWGPLDATSAGEKAPSPWGSIRTGAQAAHVWTPVAGPCSVSCGRGLMELRFVCT
DSALRVPVQEELCGLASKPGSRREVCQAVLCPAEWRYKLAACSVSCGGGVVRRILYCARA
HGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWKVMSLGPCSASCGLGTARRSVACV
RLDQGQDVEVDEVACAALVRPQASVPCLIADCTYRWHVGTWMECSVSCGDGIQRRRNTCL
GLQAQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPSPVPHEEAAAPGQTTATPAGASLE
WSQARALLFSPAPQPRRLLPGPQENSAQSSACGRQHLEPTGTIDMRGPGQADCAVAIGRP
LGEVVTLHVLESSLNCSAGDMLLLWGRLTWRKMCRKLSDMTLSSKTNTLVVRQRCGRPGG
GVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIH
ALATNMGTGTEGANASYISIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQAS
LRGQYWTLQSWVPEVQDPQSWKGKEGT
Download sequence
Identical sequences H2PTU9
ENSPPYP00000022133 ENSPPYP00000022133 9600.ENSPPYP00000022133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]