SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022189 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022189
Domain Number 1 Region: 748-912
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-31
Family MAM domain 0.0028
Further Details:      
 
Domain Number 2 Region: 589-746
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-27
Family MAM domain 0.00093
Further Details:      
 
Domain Number 3 Region: 473-586
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-23
Family MAM domain 0.0024
Further Details:      
 
Domain Number 4 Region: 158-311
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-18
Family MAM domain 0.017
Further Details:      
 
Domain Number 5 Region: 1-108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000617
Family MAM domain 0.013
Further Details:      
 
Domain Number 6 Region: 113-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 377-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000316
Family MAM domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000022189
Domain Number - Region: 344-383
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000288
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022189   Gene: ENSPPYG00000019788   Transcript: ENSPPYT00000023102
Sequence length 995
Comment pep:known_by_projection chromosome:PPYG2:9:133849662:133856684:1 gene:ENSPPYG00000019788 transcript:ENSPPYT00000023102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGTHQGKEASTAVLRSPTLREAASSCKLRLWYHAASGDVAELRLELTHGPETLTLWQS
TGPWGPGWQELAVTTGRIQGDFRVTFSATRNATHRGAVALDDLEFWDCGLPTPQASCPLG
HHHCQNKVCVEPQQLCDGEDNCGDLSDENPHTCGRHIATDFETGLGPWNRSEGWSRNHSA
GGPERPSWPRRDHSRNSAQGSFLVSVAEPGTPAILSSPEFQASGTSKCSLVFYHYLHGSE
AGCLQLFLQTLGPGAPQAPVLLRRRRGELGTAWVRDRVDIQSTHPFQILLAGQTGPGGVV
GLDDLILSDHCRPVLEVSTLQPLPPGPWAPAPQPLLPSSRLQDSCKQGHLACGDLCVPPE
QLCDFEEQCAGGEDEQACGTTDFESPEAGGWEDASVGRLQWRRLSAQESQGSSAAAAGEA
QGHFLSLQRAWGQLSAEARVLTPLLGPSGPRCELHLAYYLQSQLRGFLALVHFVLLDPTD
PLAWGHSAHLLSRPQVPTAPTECLSFWYHLHGPQIGTLRLAMRREGEETHLWSRSGTQGN
RWHEAWATLSHQPGSRAQYQLLFEGLRDGYHGTMALDDVAVRPGPCWAPNYCSFEDSDCG
FSPGGQGLWRRQASASGHAAWGPPTDHTTETAQGHYMVVDTSPDALPRGQTASLTSKEHR
PLAQPACLTFWYHGSLRSPGTLRVYLEERGRHQVLNLSAHGGLAWRLGSVDVQAERAWRV
VFEAVATDVAHSYVALDDLLLQDGPCPQPGSCDFESGLCGWSHLAWPSLGGYSWDWGGGA
TPSRYPQPPVDHTLGTEAGHFAFFETGVLGPGGRAAWLRSEPLPATPASCLRFWYHMGFP
EHFYKGELKVLLHSAQGQLAVWGAGGHRRHQWLEAQVEVASAKEFQIVFEATLGSQPALG
PIALDDVEYLAGQRCQQPAPSPGDTATPVSVPAAVGSALLLLMLLVLLGLGGRRWLQKRG
SCPFQSNREATAPGFDNILFNVDGVSLPASVTSDP
Download sequence
Identical sequences H2PU04
ENSPPYP00000022189 9600.ENSPPYP00000022189 ENSPPYP00000022189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]