SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022216 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000022216
Domain Number - Region: 7-98
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00018
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022216   Gene: ENSPPYG00000019813   Transcript: ENSPPYT00000023129
Sequence length 119
Comment pep:known_by_projection chromosome:PPYG2:9:134193280:134194454:1 gene:ENSPPYG00000019813 transcript:ENSPPYT00000023129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNEN
LARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATASDQKSSGGRDS
Download sequence
Identical sequences H2PU31
ENSPPYP00000022216 9600.ENSPPYP00000022216 XP_002820468.1.23681 ENSPPYP00000022216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]