SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022309 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022309
Domain Number 1 Region: 52-113
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-19
Family Chaperone J-domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022309   Gene: ENSPPYG00000019918   Transcript: ENSPPYT00000023239
Sequence length 116
Comment pep:novel chromosome:PPYG2:Un:3301720:3302070:-1 gene:ENSPPYG00000019918 transcript:ENSPPYT00000023239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGSYYRGGFEPKMTK
REAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Download sequence
Identical sequences H2PUC3
ENSPPYP00000022309 9600.ENSPPYP00000022309 ENSPPYP00000022309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]