SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022319 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022319
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.45e-30
Family Skp1 dimerisation domain-like 0.00000888
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily POZ domain 9.16e-23
Family BTB/POZ domain 0.0000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022319   Gene: ENSPPYG00000019927   Transcript: ENSPPYT00000023249
Sequence length 162
Comment pep:novel chromosome:PPYG2:Un:4894826:4895311:-1 gene:ENSPPYG00000019927 transcript:ENSPPYT00000023249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDPVPLPNVNAAVFKKVIQW
YTHHKDDPPPPEDDENKEKQTDDIPVWDQEFLKVAQGTLFELILAANYLDIKGLLDVTCK
TIANMIKGRTPEEIRRTFNTKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences H2PUD3
ENSPPYP00000022319 9600.ENSPPYP00000022319 ENSPPYP00000022319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]