SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022374 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022374
Domain Number 1 Region: 34-253
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.08e-50
Family Ankyrin repeat 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022374   Gene: ENSPPYG00000019990   Transcript: ENSPPYT00000023314
Sequence length 261
Comment pep:novel chromosome:PPYG2:Un:11826960:11840520:1 gene:ENSPPYG00000019990 transcript:ENSPPYT00000023314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKLFGFGSRRGQTAQGSIDHVYTGSGYRIRDSELQKIHKAAVKGDAAEVERCLARRSGL
DAPDKQHRTALHLACASGHVKVVTLLVNRKCQIALCDKENRTPLIQAVHCQEEACAVILL
EHGANPNLKDIYGNIALHYAVYSESTSMAEILLFHDANIEALDKDNNTPLLFAIICKKEK
MVEFLLKNKASTHAVDRLRWYTLMLAVHYDSPGIVNILLKQNINVFIQDCGDAEDYAISR
SLTKIQQQILEHKKKILKNDK
Download sequence
Identical sequences H2PUI7
9600.ENSPPYP00000022374 ENSPPYP00000022374 ENSPPYP00000022374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]