SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022677 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022677
Domain Number 1 Region: 425-731,835-875
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.85e-75
Family FAD-linked reductases, N-terminal domain 0.000000000702
Further Details:      
 
Domain Number 2 Region: 711-821
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.19e-36
Family L-aminoacid/polyamine oxidase 0.000000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022677   Gene: ENSPPYG00000020263   Transcript: ENSPPYT00000023637
Sequence length 939
Comment pep:known chromosome:PPYG2:X:44279402:44357239:1 gene:ENSPPYG00000020263 transcript:ENSPPYT00000023637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTNASASSPGGTGTVTGTSTGTGTGTGTGTGTGRKAEGPPEAGGTTAQVPNPDSSLDDT
SYSPSEWSVRSEWRSVSDPLASSQWSTSSKAEAASWSSSIHSPISTTGLSESIDSDSKSG
LRGFSAYNSSSRIPKSTTSSNSSDGAATASNQDTGIPWVLVTGPTPPVNSPLESLQGSAF
SSGFSTPRGSVKGPTLPPDSILTSVPGHTWIFVRGPPIPNDLSQVSIQAPPIPGNTPRGS
VQGSAASSVSSFPWGLVPGPPLPNNISPVSPQAPPAPHNIPSVSRQASTPTSVPDTPRGS
IQEPPAPSNPFQLPTQGHSKPNNSHQVSVQGSAPLSVPSSPRVSAETSAPPLSAPGVSAK
GFAPPTVPGSPPVSKEGSAPPPGSPGELIEGSFPPFAVPTPVPTTQESVSQSMENQEKAS
IAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGA
YVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLW
RTIDNMGKEIPADAPWEAQHADEWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHE
VSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVD
QSSNNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAIIKCMM
YYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEI
RKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVG
RIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITH
TFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Download sequence
Identical sequences A0A0A0MXS9
ENSPPYP00000022677 ENSPPYP00000022677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]