SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022680 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022680
Domain Number 1 Region: 48-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-62
Family FAD-linked reductases, N-terminal domain 0.000000000125
Further Details:      
 
Domain Number 2 Region: 337-447
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.22e-36
Family L-aminoacid/polyamine oxidase 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022680   Gene: ENSPPYG00000020264   Transcript: ENSPPYT00000023640
Sequence length 529
Comment pep:known_by_projection chromosome:PPYG2:X:44378323:44502945:-1 gene:ENSPPYG00000020264 transcript:ENSPPYT00000023640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEALVRGGSAQQAGGQAGGLAGRQDWDRGPENGAAGTREAWNGASAMSNKCDVVVVGGG
ISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAK
ELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDA
PWKAPLAEEWDNMTMKDLVDKLCWTESAKQLATLFVNLCVTAETHEVSALWFLWYVKQCG
GTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQTRENVLVETLNHE
MYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVYYKEPFWRKKDYCG
TMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEERLKKLCELYAKVLG
SPEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGILHAMGKIPEDEIWQSEPESVD
VPAQPITTTFLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Download sequence
Identical sequences H2PVD2
9600.ENSPPYP00000022680 ENSPPYP00000022680 ENSPPYP00000022680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]