SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022693 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022693
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-25
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 518-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 367-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.94e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 194-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000347
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000022693
Domain Number - Region: 311-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0298
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022693   Gene: ENSPPYG00000020276   Transcript: ENSPPYT00000023654
Sequence length 576
Comment pep:known_by_projection chromosome:PPYG2:X:47264752:47311358:-1 gene:ENSPPYG00000020276 transcript:ENSPPYT00000023654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRL
GPGEESWMADGGTPVRTCAEVWQVDEQVDHYKESQDKLLWQAAFIGKETLKDESGQECKI
CRKIIYLNTDFVSVKQRLPKYYSWGRCSKHNLNFLSQNRSYVRKKDDGCKAYWKVCLHYN
LHKAQPAEKFFDPNQRGKALHQKRALRKSQRSQTGEKLYKCTECGKVFIQKANLVVHQRT
HTGEKPYECCECAKAFSQKSTLIAHQRTHTGEKPYECSECGKTFIQKSTLIKHQRTHTGE
KPFVCDKCPKAFKSSYHLIRHEKTHIRQAFYKGIKCTKSSLIYQMIHTSEKPECSEHGKA
SDERPSPTKHWRTHTKENIYECSKCGKSFRGKSHLSVHQRIHTGEKPYECSICGKTFSGK
SHLSVHHRTHTGEKPYECRRCGKAFGEKSTLIVHQRMHTGEKPYKCNECGKAFSEKSPLI
KHQRIHTGERPYECTDCKKAFSRKSTLIKHQRIHTGEKPYKCNECGKAFSVKSTLIVHHR
THTGEKPYECRDCGKAFSGKSTLIKHQRSHTGDKNL
Download sequence
Identical sequences H2PVE5
ENSPPYP00000022693 ENSPPYP00000022693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]