SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022727 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022727
Domain Number 1 Region: 20-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000275
Family KRAB domain (Kruppel-associated box) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022727   Gene: ENSPPYG00000020306   Transcript: ENSPPYT00000023689
Sequence length 188
Comment pep:known_by_projection chromosome:PPYG2:X:49087801:49095852:-1 gene:ENSPPYG00000020306 transcript:ENSPPYT00000023689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDDAFARRPRAGAQIPEKVQKVFDDVAKYFSKKEWEKMKSSEKIIYVYMKRKYEAMTK
LGFKATLSPFMRNKRATDLQGNDFDNHCNHGNQVERPQMTFGRLQRTIPKIMPEKPAEEG
NDSKGVSEASGSQNDGKQLCPPGKPSTSEKIHKRSGPKRGKRARTHRLRERNQLVIYEEI
SDPEEDDK
Download sequence
Identical sequences H2PVH8
XP_002831638.1.23681 ENSPPYP00000022727 ENSPPYP00000022727 9600.ENSPPYP00000022727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]