SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022842 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022842
Domain Number 1 Region: 312-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000162
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000184
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 476-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000187
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 361-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000277
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 5 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000707
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000022842
Domain Number - Region: 546-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00424
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022842   Gene: ENSPPYG00000020407   Transcript: ENSPPYT00000023805
Sequence length 801
Comment pep:known_by_projection chromosome:PPYG2:X:58161444:58163849:1 gene:ENSPPYG00000020407 transcript:ENSPPYT00000023805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPKLLPACGTLQGGGGIPAGGGRVHRGPDPPAGQVPTRRLLLVRGPQDGGPGRRREEA
RTASRGPGPSLLAPRPDQPSGGGGGGGDDFFLVLLDPVGGDVETAGSGQAAGPVLREEAE
KGPGLQGGESGANPAGPTALGPRCLSAVPTPAPISAPGPAAAFAGTVTIHNQDLLLRFEN
GVLTLATPPPHAWEPGAAPAQQPGCLIAPQAGFPHAAQPGDCPELPPDLLLAEPAEPAPA
PAPEEEAEGPAAALGPRGPLGSGPGVVLYLCPEAQCGQTFAKKHQLKVHLLTHSSSQGQR
PFKCPLGGCGWTFTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTVYNLKAHMKGHEQEN
SFKCEVCEESFPTQAKLSAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQE
LFSCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDR
RFMCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVEGCCARFSARSSLYIHSKKHLQDV
DTWKSRCPISTCNKLFTSKHSMKTHMVKRHKVGQDLLAQLEAANSLTPSSELTSQRQNDL
SDAEIVSLFSDVPDSTSAALLDTALVNSGILTIDVASVSSTLAGHLPANNNNSVGQAVDP
PALMATSDPPQSLDTSLFFGTAATGFQQSSLNVDEVSSVSVGPLGSLGSLAMKNSSPEPQ
ALTPSSKLTVDTDTLTPSSTLCENSVSELLTPTKAEWSVHPDSDFFGQEGETQFGFPNAA
GNHGSQKETDLITVTGSSFLV
Download sequence
Identical sequences H2PVU0
ENSPPYP00000022842 9600.ENSPPYP00000022842 XP_002831772.1.23681 ENSPPYP00000022842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]