SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023056 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023056
Domain Number 1 Region: 216-378
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.77e-42
Family Pentapeptide repeats 0.00027
Further Details:      
 
Domain Number 2 Region: 90-193
Classification Level Classification E-value
Superfamily POZ domain 1.2e-21
Family Tetramerization domain of potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023056
Domain Number - Region: 2-76
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.000759
Family Doublecortin (DC) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023056   Gene: ENSPPYG00000020599   Transcript: ENSPPYT00000024026
Sequence length 389
Comment pep:known_by_projection chromosome:PPYG2:X:104354824:104356241:1 gene:ENSPPYG00000020599 transcript:ENSPPYT00000024026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWVTLFLNGSPKNGKVVAVYGILSDLLSVASSKLGIEATSVYNGKGGLIDDIALIRDDD
VLFVCEGEPFIDPQTDSKPPEGLLGFHTDWPTLNVGGRYFTTIRSTLVNKEPDSMLAHMF
KDKGVWGNKQYHRGAFLIYRSPEYFEPIWNYLCHRQLIVNDGINLLGVLEEARFFGIDSL
IEHLEVAIKNFQPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLRYINF
KMANLSRCNLAHANLCCANLEQADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG
LKANLEGANLKGVDMEGSQMTGINLRVANLKNAKLENCNLRGATLAGTDLENCDLSGCDL
QEANLRRSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences H2PWD9
9600.ENSPPYP00000023056 ENSPPYP00000023056 ENSPPYP00000023056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]