SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023149 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023149
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily POZ domain 7.85e-22
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 516-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000211
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 491-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000692
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023149   Gene: ENSPPYG00000020682   Transcript: ENSPPYT00000024120
Sequence length 672
Comment pep:known_by_projection chromosome:PPYG2:X:119262354:119264372:1 gene:ENSPPYG00000020682 transcript:ENSPPYT00000024120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQL
FSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPL
SQVKSISGAAQDGNTEPLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEM
KKIIVTDSDDDDDDVIFCSEILPTKETLPSNNTGAQVQSNPGPVAISDVAPSASNNSPPL
TNITPTQKLPTPVNQATLNQTQGSEKLLVSSAPTHLTPNIILLNQTPLSTPPNVSSSLPN
HMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAVSNTSLVPQAD
TSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGLGSKHLMEGQKIITLDT
ATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIPKTSGSEMANKRMKVKH
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKH
EIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
SDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY
Download sequence
Identical sequences H2PWM7
ENSPPYP00000023149 9600.ENSPPYP00000023149 XP_002832100.1.23681 XP_002832101.1.23681 ENSPPYP00000023149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]