SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023170 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023170
Domain Number 1 Region: 1193-1523
Classification Level Classification E-value
Superfamily NHL repeat 1.1e-23
Family NHL repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 1421-1657
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000051
Family SGL-like 0.045
Further Details:      
 
Domain Number 3 Region: 631-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023170
Domain Number - Region: 889-961
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000192
Family Carboxypeptidase regulatory domain 0.035
Further Details:      
 
Domain Number - Region: 697-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 600-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 729-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000495
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 565-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00164
Family Integrin beta EGF-like domains 0.067
Further Details:      
 
Domain Number - Region: 762-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00172
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 535-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.035
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 2091-2189,2281-2341
Classification Level Classification E-value
Superfamily NHL repeat 0.0968
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023170   Gene: ENSPPYG00000020699   Transcript: ENSPPYT00000024141
Sequence length 2725
Comment pep:known_by_projection chromosome:PPYG2:X:123553019:124170051:-1 gene:ENSPPYG00000020699 transcript:ENSPPYT00000024141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
SRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDM
QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQD
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYANG
VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQ
HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRHGWKGPECDVPEEQCIDPT
CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSNHGICVKGECHCSTGWGGVNCETPLP
VCQEQCSGHGTFLLDTGVCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
CEERSCHSHCTEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYISPLCQGSPDP
LDLIQQRQTLFSQHTSRLFYDRIKFLIGKDSTHVIPPEVSFDSRRACVIRGQVMAIDGTP
LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLPEKRTLWLPWNQFIV
VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
SSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAINLVYT
FAWNKTDIYGQKVWGLAEALVSVGYEYETCPDFILWEQRTVVLQGFEMDASNLGGWSLNK
HHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
ASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTRKV
YKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIY
FVDGTMIRKIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLY
VLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLF
IAETDERKVNRIQQVTTNGEISVIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSL
AVSPDGTLYVADLGNVRIRTISRNQARLNDMNLYEIASPADQELYQFTVNGTHLHTLNLI
TRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKR
VSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEK
LTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEIGLSS
EPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNASAFERRLRAHNRNLLSID
FDHITRTGKIYDDHRKFTLRILYDQTGRPILWSPVSRYNEVNITYSPSGLVTFIQRGTWN
EKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQPDCLLSVTMPSMV
RHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSE
VLYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFD
YSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTK
IFSANGQVIEVQYEILKAIAYWMTIQYDNVGRMVICDIRVGVDANITRYFYEYDADGQLQ
TVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQ
RGNDIFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLTNPIRV
THLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYT
PYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLLP
KPFNLYSFENNYPVGKIQDVAKYTTDIRSWLELFGFQLHNVLPGFPKPELENLELTYELL
RLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAVPS
VFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGS
LEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVE
EEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLS
VEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences H2PWP8
9600.ENSPPYP00000023170 XP_002832126.1.23681 ENSPPYP00000023170 ENSPPYP00000023170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]