SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023190 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000023190
Domain Number - Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000166
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 354-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0374
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 236-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0873
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023190   Gene: ENSPPYG00000020714   Transcript: ENSPPYT00000024161
Sequence length 631
Comment pep:known_by_projection chromosome:PPYG2:X:129622316:129689934:-1 gene:ENSPPYG00000020714 transcript:ENSPPYT00000024161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDKPFQPKNISKMAELFMECEEEELEPWQKKVEETQDEDDDELIFVGEISSSKPAISN
ILNRGHSSSSSKGIKSEPHSPGIPEIFRTASQRCRDPPSNPVAASPRFHPVSKSSQSSVT
VENVSKPDFTKNSQVGSDNSSILLFDSTQESLPPSQDIPAIFREGMKNTSYVLKHPSTSK
VNSVTPKKPKTSEDVPQINPSTSLPLIGSPPMTSSQVMLSKGTNTSSPYDAGADYLRACP
KCNVQFNLLDPLKYHMKHCCPDMITKFLGVIVKSERPCDEDKTNSETGKLIMLVNEFYYG
RHEGVTEKEPKTYTTFKCFSCSKVLKNNIRFMNHMKHHLELEKQNNESWENHTTCQHCYR
QYPTPFQLQCHIESTHTPHEFSTICKICELSFETEHILLQHMKDTHKPGEMPYVCQVCQF
RSSTFSDVEAHFRAAHENTKNLLCPFCLKVSKMATPYMNHYMKHQKKGVHRPTCRLQFLT
SKEKAEVTIRASLGPLQSKLPTAPSSWCRRGIHKCIECHSKIKDFANHFSIYIHCSFCKY
NTNCNKAFVNHMMSSHSNHPGKRFCIFKKHSGTLRGITLVCLKCDFLADSSGLDRMAKHL
SQRKTHTCQVIIENVSESTSTSEPTSGCSLK
Download sequence
Identical sequences H2PWR8
9600.ENSPPYP00000023190 ENSPPYP00000023190 ENSPPYP00000023190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]