SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023231 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023231
Domain Number 1 Region: 4-140,191-225
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000826
Family Ku80 subunit N-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023231   Gene: ENSPPYG00000020752   Transcript: ENSPPYT00000024202
Sequence length 898
Comment pep:known_by_projection chromosome:PPYG2:X:135036085:135099857:1 gene:ENSPPYG00000020752 transcript:ENSPPYT00000024202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPILLFLIDTSASMNQRTDLGTSYLDIAKGAVELFLKLRARDPASRGDRYMLVTYDEPPY
CIKAGWKENHATFMSELKNLQASGLTTLGQALRSSFDLLNLNRLISGIDNYGQGRNPFFL
EPSILITITDGNKLTSTAGVQEELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGVAS
TEPEQLGSVPTDESAITQMCEVTGGRSYCVRTQRMLNQCLESLVQKVQSGVVINFEKTGP
DPLPIGEDGLMDSSRPSNSFAAQPWHSCHKLIYVRPNSKTGVPVGHWPIPESFWPDQNLP
SLPPRTSHPVVRFSCVDCEPMVIDKLPFDKYELEPSPLTQYVLERKSPHTCWQVFVTSSG
KYNELGYPFGYLKASTTLTCVNLFVMPYNYPVLLPLLDDLFKVHKLKPNLKWRQAFDSYL
KTLPPYYLLPLKKALRMMGAPNLISDNLDCGLSYSVISYLKKLSQQTKLESERILASVGK
KPPQEIGIKVKNHSGGGMSLTHNKNFRKLLKEITGETALRLTELNTKEFAGFQIGLLNKD
LKPQTYRNAYDIPRRDLLDQLTRMRSNLLKTHKFIVGQDEDSLHSVPVAQMGNYQEYLKT
LASPLREIDPDQPKRLHTFGNPFKQDKKGMMIDEADEFVAGPQNKVKRPGEPNSPMSSKR
RRSMSLLLRKPQTPPTVTNHVGGKGPPSASWFPSYPNLIKPTLVHTDATVIHDGHEEKME
NGQITPDGFLSKSAPSELINMTGDLMPPNQVDSLSDDFTSLSKDGLIQKPGSNAFVGGAK
NCNLSVDDQKDPVASTLGTMPNTLQITPAMAQGINADIKHQLMKEVRKFGRKYERIFILL
EEVQGPLEMKKQFVEFTIKEAARFKRRVLIQYLEKVLEKIDSHHLLNNINHINSRSSC
Download sequence
Identical sequences H2PWV8
XP_003779783.1.23681 ENSPPYP00000023231 ENSPPYP00000023231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]