SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023338 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023338
Domain Number 1 Region: 31-456
Classification Level Classification E-value
Superfamily Sema domain 1.44e-100
Family Sema domain 0.00032
Further Details:      
 
Domain Number 2 Region: 1351-1479,1674-1826
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.33e-39
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 908-997
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000373
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 816-911
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000712
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 459-511
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000327
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 996-1040,1078-1131
Classification Level Classification E-value
Superfamily E set domains 0.00000294
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.06
Further Details:      
 
Domain Number 7 Region: 1145-1225
Classification Level Classification E-value
Superfamily E set domains 0.0000638
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023338
Domain Number - Region: 613-645
Classification Level Classification E-value
Superfamily Plexin repeat 0.0785
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023338   Gene: ENSPPYG00000020853   Transcript: ENSPPYT00000024315
Sequence length 1834
Comment pep:known_by_projection chromosome:PPYG2:X:153995988:154007497:1 gene:ENSPPYG00000020853 transcript:ENSPPYT00000024315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVMAHWPPFGLCLLLLLLSSPPLPLTGAHRFSAPNTTLNHLALAPGRGTLYVGAVNHLF
QLGPELQLEAVAVTGPVIDSPDCVPFRDPAECPQAQLTDNANQLLLVSSRAQELVACGQV
RQGVCETRRLGDVAEVLYQAEDPGDGQFVAANTPGVATVGLVVPLPGRDLLLVARGLAGK
LSAGVPPLAIRQLAGSQPFSSEGLGRLVVGDFSDYNNSYVGAFADARSAYFVFRRRGARA
QAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLLGAFAAGPRGTQAALC
AFPMAELGASMEQARRLCYTAGGQGPSGAEEATVEYGVTSRCVTLPLDSPESYPCGDEHT
PSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQLHKVFLHGSQGQVYHS
QQVGPPGSAISPDLLLDSSGSHLYVLTAHQVDRIPVAACPQFPDCASCLQAQDPLCGWCV
LQGRCTQKGQCRRAGQPNQWLWSYEDSHCLHIQSLLPGHHPRQEQGQVTLSVPRLPILDA
DEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTVPLALMFEDVAVAATNF
SFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPEGERTIYSAQEEDVRVR
GPGACPQVEGLAGPHLVPVGWESHLVLRVRNLQHFRGLPASFHCWLELPGELRGLPATLE
ETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNAHALYVILYDCAMGHPDCS
HCQAANRSLGCLWCADGQPACRYGPLCPPGAVELLCPAPSIDAVEPLTGPPEGGLALTIL
GSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPNGTTGPVRVAIKSQPPG
ISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSAFVGGQPCPILEPVCPE
AIVCRTRPQAVPGEAAVLVVFGHAQRTLLASPFRYTANPRLVAAEPSASFRGGGRLIRVR
GTGLDVVQRPLLSVWLEADTEVQASRAQPQDSQPRRSCGAPAADPQACIQLGGGLLQCST
VCSVNSSSLLLCRSPAVPDRARPQRVFFILDNVQVDFASASGGQGFLYQPNPRLAPLSRE
GPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTLTRNHLYCEPPAHAPQP
ANGSGLPQFVVQMGNVQLALGPVQYEAEPLLSAFPVEAQAGVGMGAAVLIAAVLLLTLMY
RHKSKQALRDYQKVLLQLESLETGVGDQCRKEFTDLMTEMTDLSSDLEASGIPFLDYRTY
AERAFFPGHGGCPLQPKPEGPGEDGRCATVCQGLTQLSNLLNSKLFLLTLIHTLEEQPSF
SQRDRCHVASLLSLALHGKLEYLTDIMRTLLGDLAAHYVHRNPKLMLRRTETMVEKLLTN
WLSICLYAFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFQPL
TLMVLVGPGAGGAAGSSEMQHVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALDL
EWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPNGATVGLVPQLHSGSTISQSLAQ
RCPLGENIPTLEDGEEGGVCLWHLVKATEEPEGTKVRCSSLREREPARAKAIPEIYLTRL
LSMKGTLQKFVDDTFQAILSVNRPIPIAVKYLFDLLDELAEKHGIEDPGTLHIWKTNSLL
LRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHKVGRDSPVNKLLYAREI
PRYKQMVERYYADIRQSSPASYQEMNSALAELSG
Download sequence
Identical sequences H2PX61
ENSPPYP00000023338 ENSPPYP00000023338 9600.ENSPPYP00000023338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]