SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023373 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023373
Domain Number 1 Region: 51-369
Classification Level Classification E-value
Superfamily Sema domain 1.83e-78
Family Sema domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1209-1338,1533-1722
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-51
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 900-1005
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000198
Family Other IPT/TIG domains 0.084
Further Details:      
 
Domain Number 4 Region: 813-902
Classification Level Classification E-value
Superfamily E set domains 0.00000000000056
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 5 Region: 718-813
Classification Level Classification E-value
Superfamily E set domains 0.000000000000642
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 372-422
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1003-1082
Classification Level Classification E-value
Superfamily E set domains 0.00000168
Family E-set domains of sugar-utilizing enzymes 0.068
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023373
Domain Number - Region: 670-704
Classification Level Classification E-value
Superfamily Plexin repeat 0.000262
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 516-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.0458
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023373   Gene: ENSPPYG00000020880   Transcript: ENSPPYT00000024351
Sequence length 1752
Comment pep:known_by_projection chromosome:PPYG2:X:154581269:154595350:1 gene:ENSPPYG00000020880 transcript:ENSPPYT00000024351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVCLLLLLFLTVGGALGNRPFRAFVVTDTTLTHLAVHHLTELRAHSTRPVEDKSEYFP
TLSSRKLISDEDSADMFSLVYQDEFVSSQIKIPSDTLSLYPAFDIYYIYGFVSASFVYFL
TLQLDTQQTLLDTAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWRGVEYRLVQSAHLAK
PGLLLAQALGVPADEDVLFIIFSQGQKNRASPPRQTILCLFTLSNINAHIRRRIQSCYRG
EGTLALPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLRVIEGLPLLADSTDGMASVAA
YTYRQHSVVFIGTRSGSLKKVRVDGSQDAHLYETVPVVDGSPILRDLLFSPDHRHIYLLS
EKQVSQLPVETCEQYQSCAACLGSGDPHCGWCVLQHRCCREGACLGASAPHGFAEELSKC
VQVRVRPNNVSVTSPGVQLTVTLHNVPDLSAGVSCAFEEAAESEAILLPSGELLCPSPSL
QELRALTRGHGATRTVRLQLLSKETGVRFAGADFVFYNCSVLQSCMSCVGSPYPCHWCKY
RHACTSRPHECSFQEGRVHSPEGCPEILPSGDLLIPVGVMQPLTLRAKNLPQPQSGQKNY
ECVVRVQGRQQRVPAVRFNSSSVQCQNASYSYEGDEHGDTELDFSVVWDGDFPIDKPPSF
RALLYKCWAQRPSCGLCLKADPRFNCGWCISEHRCQLRTHCPAPKTNWMHLSQKGTRCSH
PRIMQIHPLVGPKEGGTRVTIVGENLGLLSREVGLRVAGVRCNSIPAEYISAERIVCEME
ESLVPSPLPGPVELCVGDCSADFRTQSEQLYSFVTPTFDQVSPSRGPASGGTRLTISGSS
LDAGSRVTVTVRDSECQFVRRDAKAIVCISPVSTLGPSQAPITLAIDRANISSPGVIYTY
TQDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLC
KAPGIFLGRPQPRAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVK
PGSHVVLKGKNLIPAAAGSSRLNYTVLIGGQPCSLTVSDTQLLCDSPSQTGRQPVMVLVG
GLEFWLGTLHISAERALTLPAMMGLAAGGGLLLLAITAVLVAYKRKTQDADRTLKRLQLQ
MDNLESRVALECKEAFAELQTDINELTNHMDEVQIPFLDYRTYAVRVLFPGIEAHPVLKE
LDTPPNVEKALRLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVALQSRLDYA
TGLLKQLLADLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLL
YCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVCPENESSAQVPVKVLN
CDSITQAKDKLLDTVYKGIPYSQRPKAEDMDLEWRQGRMTRIILQDEDVTTKIECDWKRL
NSLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTASSPDSLRSRAPMIT
PDQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFST
AHRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH
KNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMA
SISDQDMDAYLVEQSRLHASDFNVLSALSELYFYVTKYRQEILTALDRDASCRKHKLRQK
LEQIISLVSSDS
Download sequence
Identical sequences H2PX94
9600.ENSPPYP00000023373 ENSPPYP00000023373 ENSPPYP00000023373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]