SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023469 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023469
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily Ribosomal protein S18 4.45e-25
Family Ribosomal protein S18 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023469   Gene: ENSPPYG00000025835   Transcript: ENSPPYT00000029314
Sequence length 143
Comment pep:novel chromosome:PPYG2:X:54227478:54227906:1 gene:ENSPPYG00000025835 transcript:ENSPPYT00000029314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAMVAVCGGLGRKKLTHLVTAAVSLTHPGTPTVLSRRGYSQYKQVSSIEDLPTPMENPYK
ESLKKCILCGKHVNYKNAQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGF
MPVTYKDPAYLKDPKVCNIRYQE
Download sequence
Identical sequences H2PXH6
9600.ENSPPYP00000023469 ENSPPYP00000023469 ENSPPYP00000023469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]