SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023571 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023571
Domain Number 1 Region: 108-163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-20
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 2 Region: 70-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000001
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 3 Region: 152-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000192
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023571   Gene: ENSPPYG00000025949   Transcript: ENSPPYT00000029428
Sequence length 189
Comment pep:known_by_projection chromosome:PPYG2:14:101780235:101796420:1 gene:ENSPPYG00000025949 transcript:ENSPPYT00000029428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPR
KIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQL
VHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHIL
THAKAKNNQ
Download sequence
Identical sequences A0A2K5IH29 A0A2K5YVK2 A0A2K6UAL6 G3TSY4 H0WVA2 H2PXS7
ENSDNOP00000016888 ENSNLEP00000001171 ENSOGAP00000006227 ENSLAFP00000018692 9600.ENSPPYP00000023571 ENSPPYP00000023571 ENSNLEP00000001171 ENSPPYP00000023571 ENSOGAP00000006227 XP_021535516.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]