SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023582 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023582
Domain Number 1 Region: 67-355
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.62e-52
Family Glycerol-3-phosphate transporter 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023582   Gene: ENSPPYG00000029826   Transcript: ENSPPYT00000032849
Sequence length 360
Comment pep:known_by_projection chromosome:PPYG2:11:47575576:47608134:-1 gene:ENSPPYG00000029826 transcript:ENSPPYT00000032849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVKQRILAPGKEGLKNFAGKSLGQIYRVLEKKQDTGETIELTEDGKPLEVPERKAPLC
DCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHRGGKVIKEKAKFNWD
PETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCV
IFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYT
GWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFK
TPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVCKMYSYINCGLP
Download sequence
Identical sequences K7ESR5
ENSPPYP00000023582 ENSPPYP00000023582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]