SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023596 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000023596
Domain Number - Region: 2184-2292
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000575
Family Myosin rod fragments 0.0055
Further Details:      
 
Domain Number - Region: 866-965
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0059
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number - Region: 1268-1384
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0837
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023596   Gene: ENSPPYG00000029668   Transcript: ENSPPYT00000032864
Sequence length 2360
Comment pep:known_by_projection chromosome:PPYG2:3:11018596:11057300:1 gene:ENSPPYG00000029668 transcript:ENSPPYT00000032864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQL
VVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKHIEEMKAQGGT
VLPAELQSEEQLSKHDKSSTEEEMEVEKIKHKLQEKEELISTLQAQLTQAQAEQAAQSST
EMEEFVMMKQQLQEKEELISTLQAQLSQTQAEQAAQKLRVLQRKLEEHEESLVGRAQVVD
LLQQELTAAEQRNQILSQQLQQMEAEHNTLRNTVETEREESKTLLEKMELEVAERKLSFH
NLQEQMRHLLEQFEQAGQAQAELESRYSALEQKHKAEMEEKTSHILSLQKTGQELQSACD
ALKDQNSKLLQDKNEQAVQSAQTIQQLEDQLQQKSKEISQFLNRLPLQQHETASQTSFPD
VYNEGTQAVTEENIASLQKRVVELENEKGALLLSSIELEELKAENEKLSSQITLLEAQNR
TGEADREVSEISIVDIANKRSSSAEESGQDVLENTFSQKHKELSVLLLEMKEAQEEIAFL
KLQLQGKRAEEGDHEVLDQKEMKQMEGEGIAPIKMKVFLEDTGQDFPLMPNEESSLPAVE
KEQASTEHQSRTSEEISLNDAGVELKSTKQDGNKSLSAVPDIGQCHQDELERLKSQILEL
ELNFHKVQEIYEKNLDEKAKEISNLNQLIEEFKKNADNNRSAFTALSEERDQLLSQVKEL
SIVTELRAQVKQLEMNLAEAERQRRLDYESQTAHDNLLTEQIHSLSIEAKSKDVKIEVLQ
NELDDVQLQFSEQSTLIRSLQSQLQNKESEVLEGAERVRHILSKVEELSQALSQKELEIA
KMDQLLLEKKRDVETLQQTIEEKDQQVTEISFSMTEKMVQLNEEKFSLGVEIKTLKEQLN
LLSRAEEAKKEQVEEDNEVASDLKQNYSEMSPARQISKEELQHEFDLLKKENEQRKRKLQ
AALINRKELLQRVSRLEEELANLKDESKKEISLSESERGEVEEDKENKEYSEKCVTSKCQ
EIEIYLKQTISEKEVELEHIRKDLEEKMAAEEQLQAVVKQMNQTLQDKTNQIDLLQAEIS
ENQAIIQKLTTSNTDASDGDSVALVKETVVISPPCTGSSEHWRPELEEKILALEKEKEQL
QKKLQEALTSRKAILKKAQEKERHLREELKQQKDDYNRLQERFDEQSKENENIGDQLRQL
QIQVRESIDGKLPSTDQQESCSPTPGLEEPLFKATEQHHTQPVLESNLCPDWPSHSEDAS
TLQGGTSVAQIKAQLKEIEAEKVELELKVSSTTSELTKKSEEVFQLQEQINKQGLEIESL
KTASHEAEVRAESLQQKLESSQLQIAGLEHLRELQPELDELQKLISKKEEDVSYLSGQLN
EKEAALTKIQTEITEQEDLIKALHTQLEMQAKEHGERIKQLQVELCEMKQKPEEIGEESR
AKQQIQRKLQAALISRKEALKENKSLQEELSLARGTIERLTKSLADVESQVSAQNKEKDT
ALGRLALLQEERDKLITEVDRSLLENQSLSGSCESLKLALEGLTEDKEKLVKEIESLKSS
KIAESTEWQEKHKELQKEYEILLQSYENVSNEAERIQHVVETVRQEKQELYGKLRSTEAN
KKETEKQLQEAEQEMEEMKEKMRKFAKSKQQKILELEEENYRLRAEVHPAGDTAKECMET
LLSSNASMKEELERVKMEYETLSKKFQSLMSEKDSLSEEVQDLKHQIEGNVSKQANLEAT
EKHDNQTNVTEEATQSIPGETEEQDSLSMSTRPACLESVPSANSANPAVSEDFSSHDEIN
NYLQQIDQLKERIAGLEEEKQKNKEFSQTLENEKNALLSQISTKDGELKMLQEEVTKMNL
LNQQIQEELSRVTKLKETAEEEKDDLEERLMNQLAELNGSIGNYCQDVTDAQIKNELLES
EMKNLKKCVSELEEEKQQLVKEKTKVESEIRKEYLEKIQGAQKEPGNKSHAKELQELLKE
KQQEVKQLQKDCIRYQEKISALERTVKALEFVQTESQKDLEITKENLAQAVEHRKKAQAE
LASFKVLLDDTQSEAARVLADNLKLKKELQSNKESVKSQMKQKDEDLERRLEQAEEKHLK
EKKNMQEKLDALHREKVHLEETIGEIQVTLNKKDKEVQQLQENLDSTVAQLAAFTKSMSS
LQDDRDRVIDEAKKWERKFSDAIQTKEEEIRLKEDNCSVLKDQLRQMSIHMEELKINISR
LEHDKQIWESKAQTEVQLQQKVCDTLQGENKELSSQLEETRHLYHNSQNELAKLESELKI
LKDQLTDLSNSLEKCKEQKENLEGIIRQQEADIQNSKFSYEQLETDLQASRELTSRLHEE
INMKEQKIISCFLARKRQSK
Download sequence
Identical sequences K7ESS9
ENSPPYP00000023596 ENSPPYP00000023596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]