SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023643 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023643
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-24
Family HkH motif-containing C2H2 finger 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023643   Gene: ENSPPYG00000029902   Transcript: ENSPPYT00000032910
Sequence length 99
Comment pep:known_by_projection chromosome:PPYG2:6:34768566:34777931:1 gene:ENSPPYG00000029902 transcript:ENSPPYT00000032910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPAGAMIPPPPSLRKFKLLILRGVTGQAV
Download sequence
Identical sequences K7ESX5
ENSPPYP00000023643 ENSPPYP00000023643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]