SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023702 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023702
Domain Number 1 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 495-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 540-592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-18
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 8 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 289-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000284
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023702
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00484
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023702   Gene: ENSPPYG00000010541   Transcript: ENSPPYT00000032969
Sequence length 599
Comment pep:novel chromosome:PPYG2:19_random:3613511:3627900:1 gene:ENSPPYG00000010541 transcript:ENSPPYT00000032969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYRNLVFLGICLPDLSIISMLEQRRDPRNLQSEMKMANNPGGRECINGVNTESSSKL
GSNAGNKSLKNQLGLTFQLHLSELQLFQAERNISGCKHVEKPINNNSLVSPLQKIYSSVK
SHILNKYRNDFDDSPFLSQEQKAQIREKPCECNEHGKFFRVSSSLANHQVIHTADNPYKC
NECDKVFSNSSNLVQHQRIHTGEKPYKCHECGKLFNRISLLARHQRIHTGEKPYKCNECG
KVFTQNSHLANHHRIHTGEKPYKCNECGKVFNRNAHLARHQKIHSGEKPYKCKECGKAFS
GGSGLTAHLVIHTGEKLYKCIKCGKVFSRNAHLTRHQRIHTGEKPYECKECGKVFRHKFC
LTNHHRMHTGEQPYKCNECGKVFSYNSHLAQHQRIHTGEKPYKCSDCGKVFSRLSCLTRH
QRVHTGEKPYKCNECGKAFRDSSGLTAHLLIHTGEKPYKCKECAKVFRHRLSLSNHQRFH
TGEKPYRCNECGKDFTRNSNLANHHRIHTGEKPYKCGECDKVFSHNSHLARHRQIHTGEK
PYKCNECGKVFSHKLYLKKHEGIHTGEKPYRCHECGKDFTRNSNLANHHRIHTGEKPYR
Download sequence
Identical sequences K7ET34
ENSPPYP00000023702 ENSPPYP00000023702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]