SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023733 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023733
Domain Number 1 Region: 130-174
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000174
Family MYND zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023733   Gene: ENSPPYG00000029411   Transcript: ENSPPYT00000032998
Sequence length 177
Comment pep:novel chromosome:PPYG2:6:174180587:174181924:-1 gene:ENSPPYG00000029411 transcript:ENSPPYT00000032998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPRALACELCGRPLSF
LLQVYAPLPGRPDAFHRCIFLFCCRKQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPET
GESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPGG
Download sequence
Identical sequences K7ET64
ENSPPYP00000023733 ENSPPYP00000023733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]