SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023753 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023753
Domain Number 1 Region: 81-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.14e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000863
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023753   Gene: ENSPPYG00000016711   Transcript: ENSPPYT00000033017
Sequence length 222
Comment pep:known_by_projection chromosome:PPYG2:6:53111160:53246976:-1 gene:ENSPPYG00000016711 transcript:ENSPPYT00000033017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPRLHYFNARGRMESTRWLLAAAGVEFEEKFMKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPFSQPEEQGAN
LALIKEKTKNRYFPAFEKILKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDAKSLEESRKIFRF
Download sequence
Identical sequences K7ET84
ENSPPYP00000023753 ENSPPYP00000023753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]