SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023765 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023765
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 1.41e-85
Family Integrin A (or I) domain 0.000000357
Further Details:      
 
Domain Number 2 Region: 621-697
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.27e-17
Family Integrin beta tail domain 0.0026
Further Details:      
 
Domain Number 3 Region: 338-452
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-16
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000183
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family Integrin beta EGF-like domains 0.00041
Further Details:      
 
Domain Number 6 Region: 579-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Integrin beta EGF-like domains 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023765
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00276
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 500-527
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00642
Family Integrin beta EGF-like domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023765   Gene: ENSPPYG00000011506   Transcript: ENSPPYT00000033028
Sequence length 758
Comment pep:known_by_projection chromosome:PPYG2:21:46429534:46467305:-1 gene:ENSPPYG00000011506 transcript:ENSPPYT00000033028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLKRGCAADDIMDPTSLAETQEDHDGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKECQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKKSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVRVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSRQELEGSCRKDNNSIVCSGLGDCVCGQCLCHTSDVPGKQIYGQYCECDTVN
CERYNGQVCGGPGRGLCFCGKCRCLPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQPPLCQECPGCPSPCGKLISCAECLKFEKGPLGKNCSAACQRRQLSNNPVKGK
TCKERDSEGCWVTYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILFM
AIWKALIHLSDLREYRRXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences K7ET96
ENSPPYP00000023765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]