SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023783 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023783
Domain Number 1 Region: 237-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000562
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 270-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000332
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023783   Gene: ENSPPYG00000009687   Transcript: ENSPPYT00000033047
Sequence length 306
Comment pep:known_by_projection chromosome:PPYG2:19:16720357:16723091:1 gene:ENSPPYG00000009687 transcript:ENSPPYT00000033047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLDGLGAEAAPESPPPSPPSSAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPPGPALH
GRFLLAPPGRLVKAEPPEADGGGGYGCAPGLSRGPRGLKREGAPGPAASCMRGPGGRPPP
PPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAA
AALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHL
KAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLAL
HMKRHM
Download sequence
Identical sequences K7ETB4
ENSPPYP00000023783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]