SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023804 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023804
Domain Number 1 Region: 131-190
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 2 Region: 20-83
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000068
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 
Domain Number 3 Region: 81-132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023804   Gene: ENSPPYG00000029455   Transcript: ENSPPYT00000033069
Sequence length 234
Comment pep:novel chromosome:PPYG2:15:75556779:75561915:1 gene:ENSPPYG00000029455 transcript:ENSPPYT00000033069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTAPRWLAPACPPLPPATCHLRPCATWHSGNWNKCSRSCSGGSSVRDMQCVDTWDLRPL
QPFHCQPGPAKPPVHRPCGAQPCLSWYTSSWRECSEACGGGEQQCLVTCPEPGLCKEALR
PNTTQLCNTHPCTQWVVGPWGQCSAPCGGGVQRRLVKCVNTQTGLPEEDSDQCGHEAWPE
SSRPCGTDDCEPVEPPCCERDRLSFGFCETLHLLGRCQLPTVRTQCCCLCSAQP
Download sequence
Identical sequences K7ETD5
ENSPPYP00000023804 ENSPPYP00000023804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]