SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023842 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023842
Domain Number 1 Region: 33-186
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.02e-33
Family Pancreatic carboxypeptidases 0.0000174
Further Details:      
 
Domain Number 2 Region: 186-268
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.89e-20
Family Carboxypeptidase regulatory domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023842   Gene: ENSPPYG00000029420   Transcript: ENSPPYT00000033107
Sequence length 303
Comment pep:known_by_projection chromosome:PPYG2:10:99031437:99060030:-1 gene:ENSPPYG00000029420 transcript:ENSPPYT00000033107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWTEPRLPDLNTYIYYNEKYGAPTNHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANL
HGGAVVANYPYDKSFEHRVRGVRRTANTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYF
PDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPQEELQREWLGNREALIQFL
EQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGFD
PETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQR
GPA
Download sequence
Identical sequences K7ETH1
ENSPPYP00000023842 ENSPPYP00000023842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]