SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023848 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023848
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.44e-20
Family AlaX-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023848   Gene: ENSPPYG00000029909   Transcript: ENSPPYT00000033113
Sequence length 267
Comment pep:novel chromosome:PPYG2:17:46461774:46468408:1 gene:ENSPPYG00000029909 transcript:ENSPPYT00000033113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVRGRGLPDDHAGPIRVVSIKGVD
SNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIFLAGNRVLKWMERSHGTEKALTALLK
CGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIARRLRNSPDWGGVVVLHRKEGDSEF
MNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQ
GKATKMSRRMEAQALLQDYISIQSAKE
Download sequence
Identical sequences K7ETH7
ENSPPYP00000023848 ENSPPYP00000023848 XP_009249994.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]