SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023873 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023873
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-26
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 441-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 358-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.44e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 190-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000779
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 7 Region: 488-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000926
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 8 Region: 571-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000213
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 405-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000995
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 137-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000677
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 60-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000223
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023873   Gene: ENSPPYG00000010462   Transcript: ENSPPYT00000033138
Sequence length 617
Comment pep:known_by_projection chromosome:PPYG2:19:59396946:59403002:1 gene:ENSPPYG00000010462 transcript:ENSPPYT00000033138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENFALVATLGFWCEAENEAPSEQSVSVEGVSQVRTAESGLFQKAHPCEMCDPLLKDIL
HLAEHQGSHLTQKLCTHGLCRRRFSFSANFYQHQKQHNGENCFRGDDGGASFVKSCTVRM
LGRSFTCREEGMDLPDSSGLFQHQTTYNRVSPCRRTECMESFPHSSSLRQHQRDYDGQML
FSCSDEGKAFLDTFTFLDSQMIHAEVRPFRCLPCGNVFKEKSALINHRKIHSGETSHVCK
ECGKAFIHLHHLKMHQKFHTGKRHYTCSECGKAFSRKDTLVQHQRVHTGERSYDCSECGK
AYSRSSHLVQHQRIHTGERPYKCNECGKAFSRKDTLVQHQRFHTGERPYECSECGKFFSQ
SSHLIEHWRIHTGARPYECIECGKFFSHNSSLIKHRRVHTGARSYVCSKCGKAFGCKDTL
VQHQIIHTGARPYECSECGKAFSRKDTLVQHQKIHTGERPYECGECGKFFSHSSNLIVHQ
RIHTGAKPYECNECGKCFSHNSSLILHQRVHTGARPYVCSECGKAYISSSHLVQHKKVHT
GARPYECSECGKFFSRNSGLILHQRVHTGEKPYICSECGKAYSRSSHLVRHQKAHTGERA
HECNSFGDPLAASLKLV
Download sequence
Identical sequences K7ETK0
ENSPPYP00000023873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]