SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023897 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023897
Domain Number 1 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 501-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 557-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 629-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-18
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 8 Region: 307-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 195-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000174
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 10 Region: 409-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000033
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023897   Gene: ENSPPYG00000029892   Transcript: ENSPPYT00000033161
Sequence length 688
Comment pep:known_by_projection chromosome:PPYG2:19:54262868:54286697:-1 gene:ENSPPYG00000029892 transcript:ENSPPYT00000033161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNLEAVDISSKCMKKEVLS
TGQGNTEVFHTGTLQRHESHHVGDFCFQEIEKEIHDIEFQCQEDERNGLEAFMTKIKMLT
GSTDRDDQRHAGNKPIKDKLGSSFYSHLPELHIFQIKGEIGNQLESTTDAPSVSMSQRIS
CRPQTQISNNYGNNFLNSSLLTQKEEVHMREKSFPCDESGKAINCSSLLRKHQIIHLGDK
QYKCDVCGKLFNYKQYLACHRRCHTGEKPYKCNECGKTFSQESSLTCHHRLHTGVKPYNC
NECGKIFGQNSALLINKAIHTGEIPYKCNECNKAFNRQSQISHHRIHTGEKPYKCEECDK
VFSRKSTLETHKRIHTGEKPYKCQVCDIAFMWYSQLARHRRIHTGEKTYKCNECGKTFSH
KSSLVCHHRLHGGEKSYKCKVCDKAFVRSSQLAKHTRIHCGEKPYKCNECGKTFGQNSDL
LIHKSVHTGEQPYKCDECEKVFSRKSTLETHKISHTGEKPYKCKVCDKAFACHSYLAKHT
RIHSGEKPYKCNECSKTFSHRSYLVCHRRIHSGEKPYKCNECSKTFSRRSSLHCHRRLHS
GEKPYKCNECGNTFRHWPSLIYHRRLHTGEKSYKCTVCDKAFVRNSLLSRHTRIHTAEKP
YKCNECGKAFNQQSHLSRHHRIHTGEKP
Download sequence
Identical sequences K7ETM4
ENSPPYP00000023897 ENSPPYP00000023897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]