SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023912 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023912
Domain Number 1 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 4-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 234-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 528-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000924
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 8 Region: 337-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000015
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 201-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000574
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 150-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000617
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 574-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000093
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023912   Gene: ENSPPYG00000029586   Transcript: ENSPPYT00000033176
Sequence length 636
Comment pep:novel chromosome:PPYG2:19:37636013:37644028:-1 gene:ENSPPYG00000029586 transcript:ENSPPYT00000033176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLMMFRDVAVDFSQEEWECLDLEQRDLYRDVMLENYSNMVSLGLCIYQPEAFSLLEKG
KDPWKILRDETRRPCPDMQSRCQTKKLLPKNGIFEREIAQLEIMKICKNHSLECLCFRGD
WEGNTQFQTLLDNQEECFKQVIRTCEKTLTFNQHTAFNLHQRLNTGDKLNEFKELGKAFI
SGSDHTQHQLIHTSEKFCGDKECVNTFLPDSEVTQYQTVHTVKKTYECKECGKSFSLRSS
LTGHKRIHTGEKPFKCKDCGKAFRFHSQLSVHKRIHTGEKSYECKECGKAFSCGSDLTRH
QRIHTGEKPYECNQCRKAFSQRSHLIKHQRIHTGEKPYECKECGKAFTRGSHLTQHQRIH
TGEKSHECKECGKAFIRGSNLAQHQNVHVGRKPYECEKCGKAYIWSSHLARHQRIHTGRK
SYECKQCGKTFTWASYLAQHEKIHNERKSYECKECGKTFLHGSEFNRHQKIHTGERNYEC
KECGKTFFRGSELNRHQKIHTGKRPYECEECGKAFLWGSQLTRHQRMHTGEEPYVCKECG
KSFIWGSQLTRHKKIHTDAEPYGCKKSSHIFSHHSYFTEQKIHNGANLCEWTDYGNTFSH
ESNFAQHQNSYTFEKSYEFKDFEKAFSSSSHFISLL
Download sequence
Identical sequences K7ETN9
XP_002829165.1.23681 XP_002829166.1.23681 XP_002829168.1.23681 XP_009230794.1.23681 XP_009230795.1.23681 ENSPPYP00000023912 ENSPPYP00000023912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]