SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024020 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024020
Domain Number 1 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 568-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-22
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 6 Region: 610-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 288-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 347-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-19
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 10 Region: 457-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000057
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024020   Gene: ENSPPYG00000029438   Transcript: ENSPPYT00000033284
Sequence length 671
Comment pep:known_by_projection chromosome:PPYG2:19:12193031:12214465:-1 gene:ENSPPYG00000029438 transcript:ENSPPYT00000033284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVAFEDVAVTFTQEEWALLDPSQKNLYRDVMQETFRNLASIGKKWKAQNIYVEYENLR
RNLRIVGERLFESKEGHQHGEILTQVPDDMLKKKTTTRVKSCESSVYGEVGSAHSSLNRH
IKDDTGHKAYEYQKYGQKPHKCKYCKKPFNCLSSVQTHERAHSGRKLYVCEECGKTFVSH
SSLQRHRIMHSGDGPYKCKFCGKALMFLSLYLIHKRTHTGEKPYECKQCGKAFSHSSSLR
IHERTHTGEKPYKCNECGKAFHSSTCLHAHKRTHTGEKPYECKQCGKAFSSSHSFQIHER
THTGEKPYECKECGKAFKCPSSVRRHERTHSRKKPYECKHCGKVLSYLTSFQNHLGMHTA
EISYKCKICGKAFYSPSSLQTHEKTHTGEKPYKCNQCGKAFNSSSSFRYHERTHTGEKPY
ECKQCGKAFRSASLLQTHGRTHTGEKPYACKECGKPFSNFSFFQIHERMHREEKPYECKG
YGKAFSLPSLFHRHERTHTGGKTYECKQCGRSFNCSSSFRYHGRTHTGEKPYECKQCGKA
FRSASQLQIHGRTHTGEKPYECKQCGKAFGSASHLQMHGRTHTGEKPYECKQCGKSFGCA
SRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRRHGRTHTGEKPYKCKQCGKVFRCSSQLQ
VHGRAHCIDTP
Download sequence
Identical sequences K7ETZ7
ENSPPYP00000024020 ENSPPYP00000024020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]