SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024153 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024153
Domain Number 1 Region: 116-371
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 419-679
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-39
Family YWTD domain 0.0000389
Further Details:      
 
Domain Number 3 Region: 373-420
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000461
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 809-847
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 71-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000641
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 6 Region: 730-770
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000733
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 771-807
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 688-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000182
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024153
Domain Number - Region: 2-55
Classification Level Classification E-value
Superfamily YWTD domain 0.00165
Family YWTD domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024153   Gene: ENSPPYG00000029873   Transcript: ENSPPYT00000033221
Sequence length 1000
Comment pep:novel chromosome:PPYG2:12:12643671:12684974:-1 gene:ENSPPYG00000029873 transcript:ENSPPYT00000033221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLM
GLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLF
SRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSAL
EHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALD
PAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIE
SSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYV
MDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFL
LFSQKSAVNRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDG
SQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQ
DRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKL
FWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGRE
GRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVL
LQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCA
SGQCIDGAFRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSD
ELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVH
GPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSST
KGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYR
Download sequence
Identical sequences K7EUC9
ENSPPYP00000024153 ENSPPYP00000024153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]