SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024154 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024154
Domain Number 1 Region: 30-155
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.98e-28
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 2882-3072
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-27
Family APC10-like 0.015
Further Details:      
 
Domain Number 3 Region: 1356-1399,1481-1524
Classification Level Classification E-value
Superfamily E set domains 0.0000000042
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 4 Region: 3623-3698
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000275
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024154
Domain Number - Region: 2850-2911,3190-3268
Classification Level Classification E-value
Superfamily ARM repeat 0.00263
Family Armadillo repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024154   Gene: ENSPPYG00000029658   Transcript: ENSPPYT00000033416
Sequence length 3875
Comment pep:known_by_projection chromosome:PPYG2:13:78474828:78651742:-1 gene:ENSPPYG00000029658 transcript:ENSPPYT00000033416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGEKRRKRMQAKSQHTLQALCDFDCELRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQ
LGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRPILDMP
YWNAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSEIFASKHIIGLVP
ASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGFGVCLDPVYDVIWRFRPNTRELWCYN
AVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGCLDTLAAMQDLKMG
VASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFG
GRGEYTAKIKLFELGPDGGDHETDGDLLAETDVLAYDCAAREKYAMMFDEPVLLQAGWWY
VAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLYRLPTSDG
SASKGKQQTSEPVHILKRSFARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQFTA
TLLDLERLRFVGTCCLRLLRVYTCEIYPVSATGKAVVEETSKLAECIGKTRTLLRKILSE
GVDHCMVKLDNDPQGYLSQPLSLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCL
DQDIQEANFKTSSSRLLAAVMSALCHTSVKLTSIFPIAYDGEVLLRSIVKQVSTENDSTL
VHRFPLLVAHMEKLSQSEENISGMTSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSN
TCGLLASIVSELTASALGSEVDGLNSLQSVKASANRFTKTSQGRSWNTGNGSPDAICFSV
DKPGIVVVGFSVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSLELVKGTYTTDDSPSD
IAEIRLDKVVPLKENVKYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTN
QTRGQIPQILYYRSEFDGDLQSQLLSKANEEDKNCSRALSVVSTVVRASKDLLHRALAVD
ADDIPELLSSSSLFSMLLPLIIAYIGPVAAAIPKVAVEVFGLVQQLLPSVAILNQKYAPP
AFNPNQSTDSTTGNQPEQGLSACTTSSHYAVIESEHPYKPACVMHYKVTFPECVRWMTIE
FDPQCGTAQSEDVLRLLIPVRTVQNSGYGPKLTSVHENLNSWIELKKFSGSSGWPTMVLV
LPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEKELANLGGVCAA
ALMKKDLALPIGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTILEALEGNLPLQ
IQSNEQSFLDDFIACVPGSSGGRLARWLQPDSYADPQKTSLILNKDDIRCGWPTTITVQT
KDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQDQAKKPQRIPGSPAVTAASSNTDMTYGGL
ASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKRPSENMLIRVNNDGTY
CANWTPGAIGLYTIHVTIDGIEIDAGLEVKVKDPPKGMIPPGTQLVKPKSEPQPNKVRKF
VAKDSAGLRIRSHPSLQSEQIGIVKVNGTITFIDEIHNDDGVWLRLNDETIKKYVPSMNG
YTEAWCLSFNQHLGKSLLVPVDNIFNASQGVRDLDVFSWTSKAFFPQESKTNTDDFFKDI
NSCCPQEATMQEQDMPFLRGGPGMYKVVKTGPSGHNIRSCPNLRGIPIGMLVLGNRVKAV
GEVTNSEGTWVQLDQNSMVEFCESDEGEAWSLARDRGGNQYLRHEDEQVLLDQNSQTPPP
SPFSVQAFNKGASCSAQGFDYGLGNNKGDQLSAILNSIQSRPNLPAPSIFDQAAKPPSSL
VHSPFVFGQPLSFQQPQLQKSPSRNLASRERIYKNYGVAGPASALSSLSHKLKGDRGNIS
TSSKPASTSGKSELSSKHSRSLKPDGRMSRTTADQKKPRGTEGLSASESLILKSDAAKLR
SDSHSRSLSPNHNTLQTLKSDGRMPSSSRAESPGPGSRLSSPKPKTLPANRSSPSGASSP
RSSSPHDKNLPQKSTAPVKTKLDPPRERSKSDSYTLDPDTLRKKKMPLTEPLRGRSTSPK
PKSVPKDSTDSPASENRAPSPHVVQENLHSEVVEVCTSSTLKTNSLTDSTCDDSSEFKSV
DEGSNKVHFSIGKAPLKDEQEMRASPKISRKCANRHTRPKKEKSSFLFKGDGSKPLEPAK
QAMSPSVAECARAVFASFLWHEGIVHDAMACSSFLKFHPELSKEHAPIRSSLNSQQPTEE
KETKLKNRHSLEISSALNMFNIAPHGPDISKMGSINKNKVLSMLKEPPLHEKCEDGKTET
TFEMSMHHTVKSKSPLPLTLQHLVAFWEDISLATIKAASQNMIFPSPGSCAVLKKKECEK
ENKKSKKEKKKKEKAEVRPRGNLFGEMAQLAVGGPEKDTICELCGESHPYPVTYHMRQAH
PGCGRYAGGQGYNSIGHFCGGWAGNCGDGGIGGSTWYLVCDRCREKYLREKQAAAREKVK
QSRRKPMQVKTPRALPTMEAHQVIKANALFLLSLSSAAEPSILCYHPAKPFQSQLPSVKE
GISEDLPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASP
NVFEEPESNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYDKQHSILPARVKAIPR
RRVNSGDTEVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLAFVIQHHDLEGLEIAM
KQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEEEDEENKTNK
ENSEQEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGSSLQQMALRC
WSLKFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLK
DLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITINCVKGINARYVSVHVD
NSRDLGNKVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDNHIIKIELKGPEN
TLRVRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEP
TPEQEEKALLSSPEGEEKATSDADLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATR
VREEWEHAISSKENANSQPNDEDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDL
FSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPPADISDIIHSTEKGDWNKL
GILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWM
KGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKNAIAETIIALTKMEEEFRSPVRCIATT
RLWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCGNLCT
DCDRFLHLHRRTKTHQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFRE
HTGKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACSKTHPCGHPCGGVKNE
EHCLPCLHGCDKSATSLKQDADDMCMICFTEALSAAPAIQLDCSHIFHLQCCRRVLENRW
LGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTP
GVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAEAGQGDDYDPRELICGACSDVSR
AQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPK
GKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF
Download sequence
Identical sequences K7EUD0
ENSPPYP00000024154 ENSPPYP00000024154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]