SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024199 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024199
Domain Number 1 Region: 9-120
Classification Level Classification E-value
Superfamily SRP19 6.41e-39
Family SRP19 0.000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024199   Gene: ENSPPYG00000029584   Transcript: ENSPPYT00000033461
Sequence length 146
Comment pep:known chromosome:PPYG2:5:113697347:113706735:1 gene:ENSPPYG00000029584 transcript:ENSPPYT00000033461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGL
NVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTR
TQKTGGADQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences A0A140TAX6
ENSPPYP00000024199 9600.ENSPPYP00000017539 NP_001125454.1.23681 ENSPPYP00000024199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]