SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024214 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024214
Domain Number 1 Region: 252-540,649-691
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.26e-73
Family FAD-linked reductases, N-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 525-639
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.73e-25
Family L-aminoacid/polyamine oxidase 0.00025
Further Details:      
 
Domain Number 3 Region: 142-248
Classification Level Classification E-value
Superfamily Homeodomain-like 3.76e-20
Family SWIRM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024214   Gene: ENSPPYG00000016264   Transcript: ENSPPYT00000033476
Sequence length 692
Comment pep:known_by_projection chromosome:PPYG2:6:18903191:18960536:1 gene:ENSPPYG00000016264 transcript:ENSPPYT00000033476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPED
LRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAAIGDASPGK
LEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDPTMYLAL
RNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVG
ADQYLLPKDYHNKSVIIIGAGPAGLAAAKQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGV
TVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNAL
LDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHLSNLEYACGSN
LHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIRLKSPVQCIDYSGGEVQV
TTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRF
WDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLEDKQVL
QQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTV
FFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences K7EUI9
ENSPPYP00000024214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]