SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024229 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024229
Domain Number 1 Region: 26-500
Classification Level Classification E-value
Superfamily Sema domain 7.59e-171
Family Sema domain 0.000000000000013
Further Details:      
 
Domain Number 2 Region: 502-553
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000667
Family Plexin repeat 0.0000388
Further Details:      
 
Domain Number 3 Region: 608-693
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000173
Family C1 set domains (antibody constant domain-like) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024229   Gene: ENSPPYG00000019360   Transcript: ENSPPYT00000033491
Sequence length 738
Comment pep:known_by_projection chromosome:PPYG2:9:84820858:84864133:-1 gene:ENSPPYG00000019360 transcript:ENSPPYT00000033491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVRLVQFHEPDIYNYSALLLSENKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLST
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVAV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFAPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDQTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPASSPKPLPPPGSSSLSCLGHVGDRRPSSPWTPWPASGAGPDSSSRV
SLLPPFLSDQAQHVHALGTFHLFCQATGPADIRFVWEKNGRALETCVPVQTHALPDGRAH
ALSWLQDAIRESAEYRCSVLSSAGNKTSKVQVAVMRPEVTHQEKWTRELSAWRAVAGEHD
RMMQSWRKAWESCSKDTL
Download sequence
Identical sequences K7EUK3
ENSPPYP00000024229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]