SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024261 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024261
Domain Number 1 Region: 56-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000572
Family HkH motif-containing C2H2 finger 0.096
Further Details:      
 
Domain Number 2 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000238
Family Classic zinc finger, C2H2 0.098
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024261
Domain Number - Region: 3-37
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000235
Family Plant C2H2 finger (QALGGH zinc finger) 0.071
Further Details:      
 
Domain Number - Region: 304-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0466
Family Classic zinc finger, C2H2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024261   Gene: ENSPPYG00000029803   Transcript: ENSPPYT00000033522
Sequence length 378
Comment pep:known_by_projection chromosome:PPYG2:5:17316444:17323556:-1 gene:ENSPPYG00000029803 transcript:ENSPPYT00000033522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE
ESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGV
DSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAEEARSVVAVGTGSRGTHDRDPSEKPPRL
QWFEQQAKKLAKQQEEDSEEEEDDLDGDDWEDIDSDEELECEDTEAMDDGVEQDAEEEEA
GEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKVHSFFIPDIEYLSDIKGLIKYLGEKVG
VGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKQGE
DPNEVRSASEKNWICVKP
Download sequence
Identical sequences K7EUN5
ENSPPYP00000024261 ENSPPYP00000024261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]